KEGG   Helicobacter pylori Lithuania75: HPLT_02120Help
Entry
HPLT_02120        CDS       T01896                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPLT_02120
Enzymes [BR:hph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPLT_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
413607..414098
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYVNPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRARKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLTLQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttgtattttaaaaatcatagtaaaatcgggaaaattttttcttcgccc
atttatgtcaatccgccttttggttacactaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttacgccatttttttgctctggttttttatatagaaagg
cgttttggccgtgcaaggaagcgcgattttaaagacgctccaagaactttagatattgac
attatcgctttcaaccaagtcattttaaggcagaacgatttgactttacctcaccctaaa
tggagtgaaagggattcggtgttagtgcctttaactttacaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system