KEGG   Helicobacter pylori Lithuania75: HPLT_02470Help
Entry
HPLT_02470        CDS       T01896                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00564  Glycerophospholipid metabolism
hph00565  Ether lipid metabolism
hph00592  alpha-Linolenic acid metabolism
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPLT_02470
   00565 Ether lipid metabolism
    HPLT_02470
   00590 Arachidonic acid metabolism
    HPLT_02470
   00591 Linoleic acid metabolism
    HPLT_02470
   00592 alpha-Linolenic acid metabolism
    HPLT_02470
Enzymes [BR:hph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPLT_02470
    3.1.1.32  phospholipase A1
     HPLT_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ADU82925
UniProt: E8QNZ3
Position
484548..485615
Genome map
AA seq 355 aa AA seqDB search
MKSILIFMIFVVCQLEGKNFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNSWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGGPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSSPNLIDYMGYGNAKIDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgatctttatgatttttgtagtttgtcagttagaaggtaaaaatttt
tcacaagataattttaaggtggattataactattatttgcgcaaacaggatttgcatatc
attaaaacgcaaaacgatttgtccaattcttggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttttgcctttttatcatagtttcacccccatttttcaatggtaccaccctaatatc
aacccgtatcaacgcaatgagtttaagttccaaatcagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctgtatttagcttatactcaaactaactggtttcaa
atttataatgacccccaatccgctcccatgcgaatgatgaatttcatgcctgaactcatc
tatgtttatcctatcaattttaaaccttttgggggtaaaatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggcgtgggaggcgcgcaatgttaccagcctttt
aataaagagggtaatcctgaaaaccaattcccaggagggcctgtcatcgttaaagattat
aacgggcaaaaagatgtgcgttggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcctaaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccagccctaatttgattgattacatggggtatggtaatgctaaa
attgattacaggagaggacgccaccattttgaattgcagctttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system