KEGG   Helicobacter pylori Lithuania75: HPLT_04160Help
Entry
HPLT_04160        CDS       T01896                                 

Definition
homoserine dehydrogenase (EC:1.1.1.3)
Orthology
K00003  
homoserine dehydrogenase [EC:1.1.1.3]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_04160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_04160
   00270 Cysteine and methionine metabolism
    HPLT_04160
   00300 Lysine biosynthesis
    HPLT_04160
Enzymes [BR:hph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     HPLT_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830855..832120
Genome map
AA seq 421 aa AA seqDB search
MKKRLNIGLVGLGCVGSAVAKILQENQEIIKDRAGVEIGIKKAVVRDVKKHKGYAFEISD
DLESLIEDKEIDIIVELMGGVEAPYLLAKKTLAKQKAFVTANKAMLAYHRYELEQTAKNT
PIGFEASVCGGIPIIKALKDGLSANHILSFKGILNGTSNYILSQMFKNQASFKDALKDAQ
HLGYAELNPEFDIKGIDAAHKLLILASLAYGIDAKLEEILIEGIEKIEPDDMEFAKEFGY
SIKLLGIAKKHPDCIELRVHPSMIKNECMLSKVDGVMNAISVIGDKVGETLYYGAGAGGE
PTASAVISDIIEIARKKSSLMLGFETPQKLPLKPKEEIQCAYYARLLVSDEKGVFSQISA
ILAQNDISLNNVLQKEIPHSNKAKILFSTHTTNEKSMLNALKELENLQSVLDTPKMIRLE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagattgaatatagggcttgtgggtttagggtgtgtggggagcgcggtcgct
aaaatcttacaagaaaatcaagaaatcatcaaagacagggccggcgtggaaattgggatt
aaaaaagcggtggtgcgagatgtgaaaaaacacaagggctatgcttttgaaatcagtgat
gatctagaaagcctgatagaagataaagaaattgatattatcgtggagcttatgggtggg
gtggaagcaccctatcttttagctaaaaaaactttagccaaacaaaaagccttcgttaca
gccaataaagccatgttagcgtaccaccgctacgaattagaacaaaccgctaaaaacacc
cccataggctttgaagcgagcgtgtgtgggggtatccccattatcaaggctttaaaagac
ggcttgagcgctaatcacatcctttcttttaaagggattttaaacggcacgagcaattac
attttaagccagatgtttaaaaatcaagcgagctttaaggacgctttgaaagacgcacaa
catttaggctacgcggaattgaaccctgaatttgacattaaaggcattgatgcggcgcac
aaattgttgattttagcgtctttagcgtatggcattgatgcgaaattagaagaaatcttg
attgaaggcattgaaaaaatagagccagacgacatggagtttgctaaagagtttggttat
agcatcaaacttttaggcatcgctaaaaaacacccagattgcattgaattaagggtgcat
ccaagcatgattaaaaatgaatgcatgctctctaaagtggatggggtgatgaacgctatc
agcgttataggggataaggtgggcgagactttgtattatggggctggggctgggggagag
cctaccgcaagcgcggtcattagcgatattatagaaatcgcaagaaaaaaaagctctcta
atgctaggctttgaaacccctcaaaaactccccctaaaacccaaagaagaaatccaatgc
gcttattatgcgcgtttgttggtgagcgacgaaaaaggggttttttctcaaattagcgcg
attttagctcaaaatgatatttcgctcaacaatgtcttacaaaaagaaatcccgcattcc
aacaaggctaaaatcttattttccacgcacaccaccaacgaaaaatctatgctgaacgcc
cttaaagaacttgaaaatttacaaagcgtgttggatacccctaagatgatccgtttggaa
aattga

DBGET integrated database retrieval system