KEGG   Helicobacter pylori Lithuania75: HPLT_04160Help
Entry
HPLT_04160        CDS       T01896                                 

Definition
(GenBank) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00260  Glycine, serine and threonine metabolism
hph00270  Cysteine and methionine metabolism
hph00300  Lysine biosynthesis
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01230  Biosynthesis of amino acids
Module
hph_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_04160
   00270 Cysteine and methionine metabolism
    HPLT_04160
   00300 Lysine biosynthesis
    HPLT_04160
Enzymes [BR:hph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     HPLT_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_4 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADU83240
UniProt: E8QPV8
Position
830855..832120
Genome map
AA seq 421 aa AA seqDB search
MKKRLNIGLVGLGCVGSAVAKILQENQEIIKDRAGVEIGIKKAVVRDVKKHKGYAFEISD
DLESLIEDKEIDIIVELMGGVEAPYLLAKKTLAKQKAFVTANKAMLAYHRYELEQTAKNT
PIGFEASVCGGIPIIKALKDGLSANHILSFKGILNGTSNYILSQMFKNQASFKDALKDAQ
HLGYAELNPEFDIKGIDAAHKLLILASLAYGIDAKLEEILIEGIEKIEPDDMEFAKEFGY
SIKLLGIAKKHPDCIELRVHPSMIKNECMLSKVDGVMNAISVIGDKVGETLYYGAGAGGE
PTASAVISDIIEIARKKSSLMLGFETPQKLPLKPKEEIQCAYYARLLVSDEKGVFSQISA
ILAQNDISLNNVLQKEIPHSNKAKILFSTHTTNEKSMLNALKELENLQSVLDTPKMIRLE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagattgaatatagggcttgtgggtttagggtgtgtggggagcgcggtcgct
aaaatcttacaagaaaatcaagaaatcatcaaagacagggccggcgtggaaattgggatt
aaaaaagcggtggtgcgagatgtgaaaaaacacaagggctatgcttttgaaatcagtgat
gatctagaaagcctgatagaagataaagaaattgatattatcgtggagcttatgggtggg
gtggaagcaccctatcttttagctaaaaaaactttagccaaacaaaaagccttcgttaca
gccaataaagccatgttagcgtaccaccgctacgaattagaacaaaccgctaaaaacacc
cccataggctttgaagcgagcgtgtgtgggggtatccccattatcaaggctttaaaagac
ggcttgagcgctaatcacatcctttcttttaaagggattttaaacggcacgagcaattac
attttaagccagatgtttaaaaatcaagcgagctttaaggacgctttgaaagacgcacaa
catttaggctacgcggaattgaaccctgaatttgacattaaaggcattgatgcggcgcac
aaattgttgattttagcgtctttagcgtatggcattgatgcgaaattagaagaaatcttg
attgaaggcattgaaaaaatagagccagacgacatggagtttgctaaagagtttggttat
agcatcaaacttttaggcatcgctaaaaaacacccagattgcattgaattaagggtgcat
ccaagcatgattaaaaatgaatgcatgctctctaaagtggatggggtgatgaacgctatc
agcgttataggggataaggtgggcgagactttgtattatggggctggggctgggggagag
cctaccgcaagcgcggtcattagcgatattatagaaatcgcaagaaaaaaaagctctcta
atgctaggctttgaaacccctcaaaaactccccctaaaacccaaagaagaaatccaatgc
gcttattatgcgcgtttgttggtgagcgacgaaaaaggggttttttctcaaattagcgcg
attttagctcaaaatgatatttcgctcaacaatgtcttacaaaaagaaatcccgcattcc
aacaaggctaaaatcttattttccacgcacaccaccaacgaaaaatctatgctgaacgcc
cttaaagaacttgaaaatttacaaagcgtgttggatacccctaagatgatccgtttggaa
aattga

DBGET integrated database retrieval system