KEGG   Helicobacter pylori Lithuania75: HPLT_05460Help
Entry
HPLT_05460        CDS       T01896                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00010  Glycolysis / Gluconeogenesis
hph00052  Galactose metabolism
hph00500  Starch and sucrose metabolism
hph00520  Amino sugar and nucleotide sugar metabolism
hph00521  Streptomycin biosynthesis
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPLT_05460 (glk)
   00052 Galactose metabolism
    HPLT_05460 (glk)
   00500 Starch and sucrose metabolism
    HPLT_05460 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPLT_05460 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPLT_05460 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPLT_05460 (glk)
Enzymes [BR:hph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPLT_05460 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADU83482
UniProt: E8QQK0
Position
1092519..1093529
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgcggtgcgaagat
tttgaaagcttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccattggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgcccctaaagcgatttta
ggaccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggcgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttaagcggt
agcggtttggtgttgatttatgaagccctgtctaagcgcaaaggtttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgtgctttgaatggggat
taccctatatgccgattgaccctagacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggagcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system