KEGG   Helicobacter pylori Lithuania75: HPLT_05500Help
Entry
HPLT_05500        CDS       T01896                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00010  Glycolysis / Gluconeogenesis
hph00020  Citrate cycle (TCA cycle)
hph00620  Pyruvate metabolism
hph00640  Propanoate metabolism
hph00650  Butanoate metabolism
hph00680  Methane metabolism
hph01100  Metabolic pathways
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
Module
hph_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPLT_05500 (porD)
   00020 Citrate cycle (TCA cycle)
    HPLT_05500 (porD)
   00620 Pyruvate metabolism
    HPLT_05500 (porD)
   00640 Propanoate metabolism
    HPLT_05500 (porD)
   00650 Butanoate metabolism
    HPLT_05500 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPLT_05500 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPLT_05500 (porD)
Enzymes [BR:hph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPLT_05500 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADU83490
UniProt: E8QQK8
Position
1099072..1099464
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgccgccattctttcaagagagggcaaatta
aaaggcgtggattattctcattgtaagggctgtggcgtgtgcgtagatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcccgctaccgcactcactcag
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system