KEGG   Helicobacter pylori Lithuania75: HPLT_05505Help
Entry
HPLT_05505        CDS       T01896                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00010  Glycolysis / Gluconeogenesis
hph00020  Citrate cycle (TCA cycle)
hph00620  Pyruvate metabolism
hph00640  Propanoate metabolism
hph00650  Butanoate metabolism
hph00680  Methane metabolism
hph01100  Metabolic pathways
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
Module
hph_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPLT_05505 (porA)
   00020 Citrate cycle (TCA cycle)
    HPLT_05505 (porA)
   00620 Pyruvate metabolism
    HPLT_05505 (porA)
   00640 Propanoate metabolism
    HPLT_05505 (porA)
   00650 Butanoate metabolism
    HPLT_05505 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPLT_05505 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPLT_05505 (porA)
Enzymes [BR:hph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPLT_05505 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADU83491
UniProt: E8QQK9
Position
1099474..1100697
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaagtgtgggacggcaataccgctagttct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatattgacggcgaatttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgctgcagcaggtgga
agggttagcactgcgactagctctcaaggtttggcgttgatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacggatttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgccatcatgagtgcttcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatttttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattctttgcgccctttcccttatgaaagattggggcaggatttgaaaaatcttaaa
gctttagcgattttagacaagagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacaagtgcggtgtatcaaacccaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system