KEGG   Helicobacter pylori Lithuania75: HPLT_06165Help
Entry
HPLT_06165        CDS       T01896                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPLT_06165
Enzymes [BR:hph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPLT_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234509..1235651
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEKIAQNHMHQKGVSFVFEIQHLPLSATFILKQEAISVGGD
FATPRDCILAKEPFYDGVLVASANQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPKSEIIDPKIEQDR
LKEILLEIKSQKLYQCAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKDKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASVLRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcactcaaaaacgctttacaaaaaataggccca
gaaaagatcgcgcaaaaccatatgcaccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgcaacattcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttggtt
gcgagcgctaaccaattagaacgccttattgttaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccacctcaaagctaaaaagcctaacgccccacag
atcatggcaatcttgaatctcacgccggatagcttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccaaagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagaaatcaaatcccaaaaactctaccaatgcgctcaattcagc
atagacacctaccatgccacaacggcccaaatggctttggagcattatttttccatcctt
aatgacgtgagcggttttaatagcattgaaatgctagaagtcgccagagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaagacaaactagaggttctagaaaaa
tacgcacttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacaatcgggcttatcaccgggcgtgaagttcaagaccggctc
gccggcactttgagtttgcatttaatggcgctgcaaaatggagcgagcgttttaagagtg
catgacattgatgagcatatcgatctcatcaaggtgtttaagagtttagaagaaacaaat
taa

DBGET integrated database retrieval system