KEGG   Helicobacter pylori Lithuania75: HPLT_06405Help
Entry
HPLT_06405        CDS       T01896                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPLT_06405
   00030 Pentose phosphate pathway
    HPLT_06405
   00051 Fructose and mannose metabolism
    HPLT_06405
   00052 Galactose metabolism
    HPLT_06405
   00500 Starch and sucrose metabolism
    HPLT_06405
   00520 Amino sugar and nucleotide sugar metabolism
    HPLT_06405
  Nucleotide metabolism
   00230 Purine metabolism
    HPLT_06405
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPLT_06405
Enzymes [BR:hph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPLT_06405
    5.4.2.8  phosphomannomutase
     HPLT_06405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1279535..1280914
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKGAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKEIPEKVNALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAILIGFAF
DGDADRIAMLSSHHVFAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDEITALEYKRALLGLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gagaagggggcttttagtatcggcgtggaattagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatcaatggtattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccttaaaagaaataccagagaaagtcaatgccctagaagcctatcagcgctatttg
atcaaggattttaagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccccagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggattgcgatgctaagttctcatcatgtttttgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggcaagacgctcatg
tataaaaccgggcacagcaatttaaaaatcaagctcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgccctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttacaagaagcacttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaataacggcgttagaatataaaagggcgttgcttgggttattagaaaaactttaa

DBGET integrated database retrieval system