KEGG   Helicobacter pylori Lithuania75: HPLT_06415Help
Entry
HPLT_06415        CDS       T01896                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_06415 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_06415 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPLT_06415 (trpA)
Enzymes [BR:hph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPLT_06415 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1281706..1282494)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKHEKMAFIPFVTLGDPNYELSFEIIKTLIASGVNALELGFAFSDPVADG
ITIQASHLRALKHASMAKNFQLLKKIRDYNHDIPIGLLAYANLIFSYGVDGFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQVAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacacgaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaattgagttttgaaatcattaaaaccttaatt
gctagcggtgtgaacgctttagaattgggctttgctttctcagaccctgtagcggatggc
atcaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagagactacaaccatgatattcccatagggcttttagcgtat
gcgaatctcattttttcttacggcgttgatggcttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcaaatctttatcgctagtcctaatgcgagcagtaaagat
ttagaacaagttgctatgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagccctacccccgcattactaggctttggcatttctaaaaaagaacacatcacaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttaaacgatgaaaacgccatgctagaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system