KEGG   Helicobacter pylori Lithuania75: HPLT_06420Help
Entry
HPLT_06420        CDS       T01896                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_06420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPLT_06420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPLT_06420
Enzymes [BR:hph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPLT_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1282496..1283671)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGEKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKEIGRAVYESASDAEALEAFSLLCQKEGIIPALESSHALAYALELA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcatcttttaaaggattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatttaaaacgagaggatttaatccat
ggcggggcgcacaagactaatcaggctttggggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttattgggtttgaaatgcgtgatttttatgggagaaaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtgagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagctttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatatttagc
gcgtttttaaacgataaagaggtcaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaagggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagcgct
gggcttgattatccaggggtggggccagaacacagctatttaaaagagattgggcgcgcg
gtttatgaaagcgcaagcgatgctgaagcgctagaggctttcagtttgttgtgccaaaaa
gaaggcattatcccggcgctagaaagctcacacgctttagcgtatgctttagaactcgct
caaaaatgcgaagaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggggtttaa

DBGET integrated database retrieval system