KEGG   Helicobacter pylori Lithuania75: HPLT_07845Help
Entry
HPLT_07845        CDS       T01896                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPLT_07845
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPLT_07845
Enzymes [BR:hph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPLT_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556774..1557742)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVGAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKALEVTEYNPTVSTKHNNEEEKQVLE
ILDLIIKHCKFKDKKRSFIMSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggaattaggggcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttgagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaggagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgatacaaagcacattcatggcatgcctttaggcatggtt
ttaaatcgtgttcgtagcgggtttaatcgcatgagcgagagcgaggaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagcgttagagattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactaggcttgcttttagaaagctttaaagacagattaaaagcgcttgaagtaacc
gaatacaaccccacggtaagcaccaaacacaataacgaagaagaaaagcaggttttagaa
atcttggatctcattattaagcactgtaaatttaaagataaaaagcgatcttttataatg
agttactga

DBGET integrated database retrieval system