KEGG   Helicobacter pylori 908: hp908_0123Help
Entry
hp908_0123        CDS       T01893                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpi  Helicobacter pylori 908
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115711..116340
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggtattgatagcgggctgatccattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctccatttcggcgcgcatt
ggcactaatcagtttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggtcttgcatgacaagatagattaccgctggaaagaagcgagcctggattcg
cccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgcttacgcacgc
cctccttatagcctagcgtattctttgcgtcataaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaatattttgtt
ttcattaaggggtgcgggatttttgcctaccatagggagctttctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system