KEGG   Helicobacter pylori 908: hp908_0203Help
Entry
hp908_0203        CDS       T01893                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00010  Glycolysis / Gluconeogenesis
hpi00051  Fructose and mannose metabolism
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01120  Microbial metabolism in diverse environments
hpi01130  Biosynthesis of antibiotics
hpi01200  Carbon metabolism
hpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp908_0203 (tpiA)
   00051 Fructose and mannose metabolism
    hp908_0203 (tpiA)
   00562 Inositol phosphate metabolism
    hp908_0203 (tpiA)
Enzymes [BR:hpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     hp908_0203 (tpiA)
Exosome [BR:hpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   hp908_0203 (tpiA)
  Exosomal proteins of bladder cancer cells
   hp908_0203 (tpiA)
  Exosomal proteins of melanoma cells
   hp908_0203 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN79334
UniProt: E1S6V6
Position
193116..193820
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPVFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKGKNFKIVY
CIGEELMTREKGLVAVKEFLSEQLGTIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaatttcaaatccgctatgcctgtttttaaaagccatgcg
tatttaaaagaattggaaaaaactttaaagccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttccaagcatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaggtaaaaattttaaaattgtctat
tgcattggcgaagaattgatgaccagagaaaagggtttagtggctgtaaaggaattttta
agcgagcaattaggaactattgatctcaattattccaatttgattgtggcttatgagcct
atttgggcgattggcaccaaaaaaagcgcgtctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system