KEGG   Helicobacter pylori 908: hp908_0244Help
Entry
hp908_0244        CDS       T01893                                 

Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpi  Helicobacter pylori 908
Brite
Enzymes [BR:hpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     hp908_0244
Secretion system [BR:hpi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   hp908_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232021..232818
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLIKVIEKQTNKKVRILETKPLKSNQD
LKIVVVEDPDTKYQIPLVVSKDGNLVIGLSGIFFSNNSEDVKLLTETNQKIQALNATQQN
SAKLNALFDEVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggacaatttgattaaagtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagactaaacccttgaaatccaatcaagat
ttaaaaatcgtggtggtagaagatccggacactaaataccaaatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcggtatcttttttagcaataatagcgaagac
gtgaagttgctcacagagaccaatcaaaaaattcaagcccttaacgctacgcaacaaaat
agcgcgaagttgaacgctctttttgatgaagtgccggctgattatgtgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaggcggctttgatccaagaagaa
atggcgaaggctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system