KEGG   Helicobacter pylori 908: hp908_0290Help
Entry
hp908_0290        CDS       T01893                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpi  Helicobacter pylori 908
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    hp908_0290
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp908_0290
Enzymes [BR:hpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     hp908_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275258..275815
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIIPQTKNCVFVTPDEVLETLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEILGLLRRHASSLIVHQDLFISHYQLLESLAQGS
DGVILDEELLKEDLKGMIDFAWRLGLSVFVETRKPDYTHLKDLGVLGVLEKNPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcttgtcgtataacccttacttgcctagaatcatt
cctcaaaccaaaaattgtgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgca
ccaagcgtgtttgatttagaaatcttagggttattgcgccgccatgcgagttctttgata
gtccatcaggatcttttcatcagccactaccagcttttagaatcgcttgctcaaggctct
gatggggtcattttagatgaagagcttttaaaagaggatttaaaaggcatgatagatttc
gcttggcgtttgggcttgagcgtgtttgtagaaacccgcaagccagactacacccattta
aaagatttaggggttttaggcgtgctggaaaaaaacccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system