KEGG   Helicobacter pylori 908: hp908_0290Help
Entry
hp908_0290        CDS       T01893                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01130  Biosynthesis of antibiotics
hpi01230  Biosynthesis of amino acids
Module
hpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp908_0290
Enzymes [BR:hpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     hp908_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS YdiH
Motif
Other DBs
NCBI-ProteinID: ADN79420
UniProt: E1S7E0
Position
275258..275815
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIIPQTKNCVFVTPDEVLETLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEILGLLRRHASSLIVHQDLFISHYQLLESLAQGS
DGVILDEELLKEDLKGMIDFAWRLGLSVFVETRKPDYTHLKDLGVLGVLEKNPHSYNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcttgtcgtataacccttacttgcctagaatcatt
cctcaaaccaaaaattgtgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgca
ccaagcgtgtttgatttagaaatcttagggttattgcgccgccatgcgagttctttgata
gtccatcaggatcttttcatcagccactaccagcttttagaatcgcttgctcaaggctct
gatggggtcattttagatgaagagcttttaaaagaggatttaaaaggcatgatagatttc
gcttggcgtttgggcttgagcgtgtttgtagaaacccgcaagccagactacacccattta
aaagatttaggggttttaggcgtgctggaaaaaaacccccattcttataatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system