KEGG   Helicobacter pylori 908: hp908_0659Help
Entry
hp908_0659        CDS       T01893                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyl transferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpi  Helicobacter pylori 908
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    hp908_0659 (galU)
   00052 Galactose metabolism
    hp908_0659 (galU)
   00500 Starch and sucrose metabolism
    hp908_0659 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    hp908_0659 (galU)
Enzymes [BR:hpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     hp908_0659 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639807..640628
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NESFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGELLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFDILRETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccatccctaaagaaatgctgcccattgtggataagcctttgatccaatacgctgtc
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacaggcaggaataaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccttaaaaagcattcgtaacattatagaaaaatgctgtttttcttatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggggaagccctcataggc
aatgagtcttttgcggtgattttagccgatgacttgtgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaggggcgaattgttagaagag
ggggtgtatgagattaaagacatggtagaaaaaccaagccaagaagacgccccaagcaat
ttagccgtcattgggcgctacattttaaccccggatatttttgatattttgcgtgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aagcgcatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system