KEGG   Helicobacter pylori 908: hp908_0708Help
Entry
hp908_0708        CDS       T01893                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyl transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00071  Fatty acid degradation
hpi00072  Synthesis and degradation of ketone bodies
hpi00280  Valine, leucine and isoleucine degradation
hpi00310  Lysine degradation
hpi00362  Benzoate degradation
hpi00380  Tryptophan metabolism
hpi00620  Pyruvate metabolism
hpi00630  Glyoxylate and dicarboxylate metabolism
hpi00640  Propanoate metabolism
hpi00650  Butanoate metabolism
hpi00900  Terpenoid backbone biosynthesis
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01120  Microbial metabolism in diverse environments
hpi01130  Biosynthesis of antibiotics
hpi01200  Carbon metabolism
hpi01212  Fatty acid metabolism
hpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    hp908_0708
   00630 Glyoxylate and dicarboxylate metabolism
    hp908_0708
   00640 Propanoate metabolism
    hp908_0708
   00650 Butanoate metabolism
    hp908_0708
  Lipid metabolism
   00071 Fatty acid degradation
    hp908_0708
   00072 Synthesis and degradation of ketone bodies
    hp908_0708
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    hp908_0708
   00310 Lysine degradation
    hp908_0708
   00380 Tryptophan metabolism
    hp908_0708
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    hp908_0708
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    hp908_0708
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    hp908_0708
Enzymes [BR:hpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     hp908_0708
Exosome [BR:hpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hp908_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADN79834
UniProt: E1S8K4
Position
complement(699292..700467)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASSLKPSDVDSVVLGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIASKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NAKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagcgctgtagggagttttttaggctct
ctaaagaatgtgggcgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agctctcttaagcctagcgatgtggattctgtcgttttaggcaatgtcttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgccggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcatctatgaaagctattcagttagcgcatgac
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattgtgggatgcgttcaatgattaccacatggggatcact
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcgctc
cagtcgcaactcaaagcgagagccgccatcaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgagtaaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggctcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcattatcattttatgcagcgct
aaaaaagcgcaaaaattggggttaaaaacaatggccactatcaaggggtttggtttgggt
ggttgtagtccggatattatgggcatatgcccaagcatcgctattaaaaacaatcttaaa
aatgccaaaatgaatctcaatgacatcaatctttttgaactcaatgaagcctttgccgct
caaagcatcgccgtgctaaaagagcttgaattaaaccctaatatcgtgaacgtgaatgga
ggcgcgatagcaattggccaccctattggcgcgagcggcgctagaatcttagtgacttta
ttgcatgaaatgaaaagaagcgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system