KEGG   Helicobacter pylori 908: hp908_0939Help
Entry
hp908_0939        CDS       T01893                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
hpi  Helicobacter pylori 908
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925472..926053
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CTSCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHLHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttaaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttggaaaac
ccttatctggcgctcaagatcacgcacgctttagaaaacgccctagaaaaccttaaaaca
tgcacatcttgtaacgcgctcagcgagagtgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagacgtgtttattttagaagac
ttaaaggactttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctctatattgaagataaattacaacacctccacctc
actttcaccaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtctcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system