KEGG   Helicobacter pylori 908: hp908_0939Help
Entry
hp908_0939        CDS       T01893                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
hpi  Helicobacter pylori 908
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    hp908_0939 (recR)
DNA repair and recombination proteins [BR:hpi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      hp908_0939 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925472..926053
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CTSCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHLHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttaaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttggaaaac
ccttatctggcgctcaagatcacgcacgctttagaaaacgccctagaaaaccttaaaaca
tgcacatcttgtaacgcgctcagcgagagtgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagacgtgtttattttagaagac
ttaaaggactttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctctatattgaagataaattacaacacctccacctc
actttcaccaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtctcgctctcaagggcgtttaattcaaggatcaaagcatga

DBGET integrated database retrieval system