KEGG   Helicobacter pylori 908: hp908_1083Help
Entry
hp908_1083        CDS       T01893                                 

Gene name
pcm
Definition
Protein-L-isoaspartate O-methyl transferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpi  Helicobacter pylori 908
Brite
Enzymes [BR:hpi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     hp908_1083 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057792..1058421
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEIHKRFNLHPKVRKAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLDNVHVKFADGNKGWERYAPYDRILFSACAKNIPQALVDQLEEGGILVAPIQENNEQVI
KRFVKQNNALHVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtatcaaaaaccatttgatgtgtgaagaaatccataagcgtttcaatttacac
cccaaagtgagaaaagctatggagagcattgaaagggaggtttttgtgccagcccccttc
aaacattttgcctacaccttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccttaaccgtggccaaaatgacgcaatatttagaaatcgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgtgtt
ttcagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttagacaacgttcatgtcaaattcgctgatgggaataagggctgggagcgatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatcccccaagcgcttgtcgat
cagcttgaagaaggcgggatattagttgcgcccattcaagaaaacaacgagcaagtgatc
aaacgctttgtgaaacaaaataacgccttgcacgtccaaaaagtgctagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system