KEGG   Helicobacter pylori 908: hp908_1095Help
Entry
hp908_1095        CDS       T01893                                 

Gene name
glk
Definition
(RefSeq) Gluco kinase (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpi  Helicobacter pylori 908
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    hp908_1095 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp908_1095 (glk)
   00052 Galactose metabolism
    hp908_1095 (glk)
   00500 Starch and sucrose metabolism
    hp908_1095 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    hp908_1095 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp908_1095 (glk)
   00524 Butirosin and neomycin biosynthesis
    hp908_1095 (glk)
Enzymes [BR:hpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     hp908_1095 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069904..1070914
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECVEVLRCEDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFAAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacaaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgtgttgaagtcttgaggtgcgaagat
tttgaaagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ttgcgccctatttatggctcttttgctgtggctacgcccatcatgggggattttgtccaa
atgacgaacaaccactggactttttctattgagacgacacggcaatgtttgaatttaaaa
aaactgcttgtcatcaatgattttgccgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgagatcaacgcccctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttacccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggcttggtgctgatttatgaagctttatccaaacgaaaaggcttagaaaaagtggcg
aaattgagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggccctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttccatccctgtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcgggcattgcgttagaaaattatttactgcatgatagaatttag

DBGET integrated database retrieval system