KEGG   Helicobacter pylori 908: hp908_1106Help
Entry
hp908_1106        CDS       T01893                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00010  Glycolysis / Gluconeogenesis
hpi00020  Citrate cycle (TCA cycle)
hpi00620  Pyruvate metabolism
hpi00640  Propanoate metabolism
hpi00650  Butanoate metabolism
hpi00680  Methane metabolism
hpi01100  Metabolic pathways
hpi01120  Microbial metabolism in diverse environments
hpi01130  Biosynthesis of antibiotics
hpi01200  Carbon metabolism
Module
hpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp908_1106
   00020 Citrate cycle (TCA cycle)
    hp908_1106
   00620 Pyruvate metabolism
    hp908_1106
   00640 Propanoate metabolism
    hp908_1106
   00650 Butanoate metabolism
    hp908_1106
  Energy metabolism
   00680 Methane metabolism
    hp908_1106
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    hp908_1106
Enzymes [BR:hpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     hp908_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ADN80229
UniProt: E1S9P9
Position
1078698..1079642
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQRPKFVAFGGDGASYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFDSNKTIELADM
AVDSLMFPLFEVFNGRELKITYRPRNIIPVRDYLAAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgtcccggttgtgggcatggcatcattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tacccgcacacttcatgggatgtgccttggattcatatcggttttgaaaatggctctacc
gctatttcaggggtagaagcgatgtataaggctttagtgaataagggccgctatcaaggt
caaagaccgaaattcgtggcgtttggaggcgatggggctagttatgatattggttttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccagcgggatcggttagctttggcaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggtcccttatgtggcgcaactctcgcctaacaaatggaaagac
atgaataaaaagattaagaccgcgctagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgattccaataagaccattgaattagcggatatg
gctgtggatagcttgatgttccccttgtttgaagtctttaatggtagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttagcggctcaaaagcgtttc
aaacaccttttcaaaaaggaaaacgaacacatcattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system