KEGG   Helicobacter pylori 908: hp908_1224Help
Entry
hp908_1224        CDS       T01893                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00860  Porphyrin and chlorophyll metabolism
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    hp908_1224 (hemD)
Enzymes [BR:hpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     hp908_1224 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: ADN80347
UniProt: E1SA76
Position
1200646..1201308
Genome map
AA seq 220 aa AA seqDB search
MHSQRIAPYKTLILNELCYYPLELDLTPFNALIFTSKNAVFSLLKTLKNSPKLKILQNIP
AYALSEPTAKTLQDHHFKTAFIGEKAHGKEFAQEILPLLEKKSVLYLRAKEIASSLDAIL
LEHGINFQQAVVYENKLKHLTLSEQNALKPQEKSVLIFTAISHAKAFLHYFEFLKSYTAI
SIGNTTALYLQEQGIQSYIAQKPSLEACLELALNLRVKEC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctcaaagaatcgccccttataaaactctcattttaaatgaattatgctactat
cctttagaattggatttaaccccttttaacgccctgattttcacttctaaaaatgcggtg
ttttccttgctaaaaaccctaaaaaacagccccaaactcaaaattttacaaaacattcct
gcttacgctttgagcgaacccaccgcaaaaactctacaagatcaccattttaaaaccgcc
tttataggggaaaaagcccatggcaaagagtttgctcaagaaatccttcctttattggaa
aaaaaaagcgttttgtatctcagggcaaaagaaattgcctcttctttagacgctattctt
ttagagcatggcatcaatttccaacaagccgttgtttatgaaaacaagctcaaacatttg
actttaagcgagcaaaacgccctaaaaccccaagaaaagagcgttcttattttcaccgcc
ataagccatgcgaaagcctttttacactattttgaatttttaaaaagttacaccgccata
agcattggcaacacgaccgctctttatttacaagaacaaggcattcaaagctatatagct
caaaagccctccttagaagcatgtttagaactggctttaaatttgagagttaaggaatgt
taa

DBGET integrated database retrieval system