KEGG   Helicobacter pylori 908: hp908_1277Help
Entry
hp908_1277        CDS       T01893                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpi  Helicobacter pylori 908
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    hp908_1277 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    hp908_1277 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp908_1277 (trpA)
Enzymes [BR:hpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     hp908_1277 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1250290..1251078)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKHEKMAFIPFVTLGDPNYELSFEIVKTLIISGVSALELGLAFSDPVADG
ITIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDGFYAQAKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQTATHSQGYIYTLARSGV
TGVSHTLENDASTIIKTLKAFSPTPALLGFGISKKEHITNAKEMGADGVICGSALVKIIE
ENLNNEDAMLEKIKRFVGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacacgaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaattgagttttgaaatcgttaaaaccttaatt
attagcggggtgagcgctttggaattgggtcttgctttttctgatcctgtagcggatggc
attaccatacaagcgagccatttaagggcgttaaaacacgcttctatggctaaaaatttc
cagcttttaaaaaagattagaggttacaaccatgatattcccatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggtttttacgctcaagctaaagaatgcggt
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattggtcatcaaatcc
gctcaaaaacaccaaatcaaacaaatctttatcgccagtcctaatgcgagcagtaaggat
ttagaacaaaccgctacacattcgcaaggctatatctacactttagccaggagtggggtt
acaggggtgagccataccctagagaacgatgcaagcacgatcatcaaaaccttaaaagct
tttagccccactccagccttactgggctttggcatttccaaaaaagaacacatcacaaac
gctaaagaaatgggcgctgatggcgtgatttgcggatcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaagacgccatgctagaaaaaattaagaggtttgtaggaggaatg
attttttaa

DBGET integrated database retrieval system