KEGG   Helicobacter pylori 908: hp908_1278Help
Entry
hp908_1278        CDS       T01893                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpi  Helicobacter pylori 908
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    hp908_1278 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    hp908_1278 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp908_1278 (trpB)
Enzymes [BR:hpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     hp908_1278 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1251075..1252256)
Genome map
AA seq 393 aa AA seqDB search
MNQKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVIFMGGKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKEIGRAIYESASDIEALEAFRLLCQKEGIIPALESSHALAYALKLA
QKCAQEKIIVVNLSGRGDKDLSTVYSTLKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaagcgtattttggggagtttggagggagttttgtgtcagaattgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcatcttttaaaggattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagtcaagctttatttaaagcgagaggatttaatccat
ggcggggcgcataagaccaatcaggccttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacgggtgctgggcagcatggcgtggcgacggctatcgct
tgtgcgttattgaacttaaaatgcgtgatttttatggggggaaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattgggcgctgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggccttgagagattgggcgagcagttacaag
gacacgcattatttactaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttacctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaggtcaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccacagcattagcgct
gggcttgattatccaggggtggggccagaacacagctatttaaaagagattgggcgcgcg
atttatgagagtgcaagcgatattgaagcactagaagccttcaggttgttgtgccaaaaa
gaaggcattataccggccctagaaagctcacacgccttagcgtatgccttaaaactcgct
caaaaatgtgcgcaagaaaagattatcgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttatagcactttaaaaggaggtttaaaatga

DBGET integrated database retrieval system