KEGG   Helicobacter pylori 908: hp908_1279Help
Entry
hp908_1279        CDS       T01893                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase/Phosphoribosyl anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01130  Biosynthesis of antibiotics
hpi01230  Biosynthesis of amino acids
Module
hpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp908_1279 (trpC)
Enzymes [BR:hpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     hp908_1279 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     hp908_1279 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADN80400
UniProt: E1SAC9
Position
complement(1252258..1253616)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSALKKNHALPINITPSDRDFKKALLEKRTSFILECKKASPSKGL
IRKDFDLLEITKTYEKFASCVSVLADSKHFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARVMGANAVLLMLSVLDDKNYLGLFNLAKSLNMSVLTEVSNKQEIERLLKLQYDIIGI
NNRDLHTLKTDIDHTLELRPLLPKDAIIISESGIYSHAQIKALAPYVSGFLVGSSLMKEK
DLKKACTKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSPKEIAQLKKSLPKTCAIWQVVSVMN
AKDLAPKAKETSLILYDTKGDKMGGNGVSFDWEILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKQLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaaactcctagaagtctctgcgcttaaa
aaaaatcacgctttaccgataaacataaccccaagcgacagggattttaaaaaagcgtta
ttggaaaaaaggacaagctttattttagagtgtaaaaaagcatcgccctccaaaggtttg
atcagaaaagattttgacttgttggaaataacgaaaacttatgaaaaatttgcctcttgc
gtttcagttttagccgattctaaacattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttgtgtaaagattttatcattgacgcttttcagatc
aaactcgctagggttatgggagctaatgcggtgcttttaatgttgagcgtgttagatgat
aaaaactatttagggctctttaatctcgccaaatccttaaacatgagcgttttaactgaa
gtttccaacaagcaagaaattgagcgcttgctcaaactccaatacgacattataggtatc
aataacagggatttacacaccttgaaaaccgatattgaccacacgctggaattacgcccc
ctgttgcctaaagacgcgatcattatcagcgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgagtggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgcactaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccttaaagatcacaaaagcggtt
aaaaaactggattttgtaggcgtgtttgtgaaagataaaatcaaaaaaatccaaaaaatc
gccaaaaaacttgatttaaaagcggtgcagctttatggctattcgcctaaagaaatcgct
caattgaaaaaatcgctccctaaaacttgcgcgatctggcaagtagtgagcgtgatgaac
gctaaagatttagcgcctaaagctaaagagacctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttagaaaatgtcaaaacg
cctttcatgctagctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaataagccccgggattaaaaataaggat
aaaatcaagcaattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system