KEGG   Helicobacter pylori J99: jhp0090Help
Entry
jhp0090           CDS       T00020                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    jhp0090 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jhp0090 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    jhp0090 (thrC)
Enzymes [BR:hpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     jhp0090 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(98623..100083)
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKERKIDFIEAVLNPNAPKGGLYTLEHFETLEWQDCLGMSYSELVEHVFELL
NLEIPKNLLASALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLVLVSTSGDTGPATLEGLAGMPNVFVVCLYPKDGTSLVQKLQMVTQNAS
NLKVFGVSGDFDDAQNALKNLLKDDDFNEALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTKRSLKQTFSPAMDILKSSNVERALFSLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
KTTLLALNEQKKNDDDKAALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaagaaagattgattttattgaagcggta
ttaaaccccaacgcccccaaaggcgggctttacactttagagcattttgaaacgctagaa
tggcaagattgtttgggcatgagctatagcgaattagtagagcatgtgtttgagctttta
aatttagaaatccctaaaaatttactagcgagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagaactc
taccatgggcctagtttggcgtttaaagatatggcgttacagcctttagcgagcttgttt
tctaatctagcggtggggaaaaacgaaaagtatttggtgttagtatccacaagtggggat
accggccctgcgactttagaaggtttagcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagcttagtccaaaaactccaaatggtaacccaaaacgccagc
aatttaaaggtgtttggggtgagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgacgattttaacgaggctttaaaagcgcgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttggaattgtataaaaaaggggcgatcaattctaaagaaaaaatcaccctagccatacca
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatc
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagagacaggg
cgttacgatttgactaagcgctctttaaagcaaactttctcgccagctatggatatttta
aaaagctccaatgtggaaagggcgctttttagcctttttgggtttgagcgaacgctggaa
ttgatgcaagctttagaagaagagaaattttatgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctccgatgaagattgtttgaaaaccattcaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaacccacgaaaaaacccttgtttctgccaccgcttcttatgaaaaattccct
aaaaccacccttttagccctgaatgagcaaaagaaaaacgatgacgataaagccgcccta
gaaacgcttaaaaacagctacaataccccggatagccaacgccttgatgatttgtttgaa
agaggcatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctattcttttg
tggctagaaaacacgcattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system