KEGG   Helicobacter pylori J99: jhp0104Help
Entry
jhp0104           CDS       T00020                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpj  Helicobacter pylori J99
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    jhp0104
Enzymes [BR:hpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     jhp0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116018..116656
Genome map
AA seq 212 aa AA seqDB search
MLNMNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgaacacacacacaagaggcattgacagcgggctgatccattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttcg
gcgcgcattggcgctaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggtcttgcatgacaagatagattaccgttggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagcctagcgtattctttgcgccataaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaattgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system