KEGG   Helicobacter pylori J99: jhp0104Help
Entry
jhp0104           CDS       T00020                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpj  Helicobacter pylori J99
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116018..116656
Genome map
AA seq 212 aa AA seqDB search
MLNMNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgaacacacacacaagaggcattgacagcgggctgatccattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttcg
gcgcgcattggcgctaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggtcttgcatgacaagatagattaccgttggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagcctagcgtattctttgcgccataaccgattgctccctagg
gattatttagggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaattgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system