KEGG   Helicobacter pylori J99: jhp0148Help
Entry
jhp0148           CDS       T00020                                 

Definition
hypothetical protein
Orthology
K07126  
 
Organism
hpj  Helicobacter pylori J99
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162372..163289
Genome map
AA seq 305 aa AA seqDB search
MIKSWTKKWFLILFLMASCFGHLVATTGEKYFKMANQALKRGDYHRAVAFYKRSCNLRMG
VGCTSLGSMYEYGDGVDQNISKAVFYYRRGCNLRNHLACASLGSMYEDGDGVQKDFPKAI
YYYRRGCHLKGGVSCGSLGFMYFNGTGVKQNYAKALSFSKYACSLNYGISCNFVGYMYKS
AKGVEKDLKKALANFKRGCHLKDGASCVSLGYLYEAGMDVKQNEEQALNLYKKGCSLKEG
SGCHNVAVMYYTGKGAPKDLEKATSYYKKGCALGFSGSCKVLEVIGKESDNLQDDAQNDT
QDSVQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagttggactaaaaagtggtttttgattttatttttaatggcaagctgtttt
ggtcatttggtggctacaaccggtgagaaatattttaagatggctaatcaagcccttaag
agaggggattaccatagagcggtggctttttataagaggagctgtaatttgaggatgggg
gttggttgcacgagtttaggctctatgtatgaatatggcgatggcgtggatcagaatatt
tcaaaagccgttttttattacagaagagggtgtaatttgaggaatcatctcgcttgcgcg
agtttaggctctatgtatgaagatggcgatggcgtgcaaaaagactttccaaaggctatc
tattattataggagagggtgccacttaaaaggtggggtgagctgcggtagtttgggtttt
atgtatttcaatggtacgggcgttaaacaaaattacgccaaagccctttctttttctaaa
tacgcttgcagtttgaattatggcattagttgtaactttgtagggtatatgtataagagc
gccaaaggcgtggagaaggatttgaaaaaagcccttgcgaattttaaaagagggtgccat
ttaaaagacggggcgagctgtgtgagcttgggatacttgtatgaagccggtatggatgtc
aaacaaaatgaagagcaggctttgaatctttataaaaagggttgctctttaaaagaaggg
agcggttgtcataatgtggcggtgatgtattacacgggtaagggagctccaaaagatttg
gagaaagccacttcatattataagaaagggtgcgctttaggctttagtggtagttgtaag
gtgttagaagtgattggcaaggagtctgataatttgcaagatgacgcgcaaaacgacacg
caagatagcgtgcaataa

DBGET integrated database retrieval system