KEGG   Helicobacter pylori J99: jhp0150Help
Entry
jhp0150           CDS       T00020                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpj  Helicobacter pylori J99
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    jhp0150 (hemB)
Enzymes [BR:hpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     jhp0150 (hemB)
Exosome [BR:hpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   jhp0150 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164693..165664)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMVRETRLNINDFIAPLFVIESDSGIKNEISSMPGVYQMSIEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKATREIKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLKILNLQGLILAESGVDILAPSNMMDGNVLSLRKALDKA
GYFHTPIMSYSTKFASSYYGPFRDVANSPPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagagcgatggtgagagaa
acacgtttaaatattaatgatttcatcgctcccttatttgtcatagaaagcgatagcggt
attaaaaacgaaatcagctccatgcctggcgtgtatcaaatgagtatagagcctctttta
aaagaatgcgaagaattagtgggtttaggcataaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagct
acgagagaaattaaaaaacgatttaaggatttgatcgttatagcggatttgtgtttttgc
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctaaagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gctccaagcaacatgatggatggcaatgttttaagcttgagaaaagcactggataaggcc
gggtattttcacacgcccatcatgagttattccactaaatttgcgagcagttattacggg
ccttttagagatgtagccaattctccgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagcttggaagatgaaaaacagggtgcg
gatattttaatggtgaagccggctttagcgtatctggatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagtggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system