KEGG   Helicobacter pylori J99: jhp0180Help
Entry
jhp0180           CDS       T00020                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jhp0180 (tpiA)
   01230 Biosynthesis of amino acids
    jhp0180 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jhp0180 (tpiA)
   00051 Fructose and mannose metabolism
    jhp0180 (tpiA)
   00562 Inositol phosphate metabolism
    jhp0180 (tpiA)
Enzymes [BR:hpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     jhp0180 (tpiA)
Exosome [BR:hpj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   jhp0180 (tpiA)
  Exosomal proteins of bladder cancer cells
   jhp0180 (tpiA)
  Exosomal proteins of melanoma cells
   jhp0180 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197063..197767
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPVFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRVLLKESPSFLKEKFDFFKGKNFKIVY
CIGEDLTTREKGFRAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaatttcaaatccgctatgcctgtttttaaaagccatgcg
tatttaaaagaattggaaaaaactttaaagccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaacgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttccaaacatttagaagaa
ctgaaaatccacacgcttttaatagggcatagcgagaggcgagtgcttttaaaggaaagc
cctagctttttgaaagaaaaatttgatttttttaaaggtaaaaattttaaaattgtctat
tgtattggcgaagatttaacgaccagagaaaagggttttagggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcttatgagcct
atttgggcgattggcactaaaaaaagcgcgtctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgattgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system