KEGG   Helicobacter pylori J99: jhp0216Help
Entry
jhp0216           CDS       T00020                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpj  Helicobacter pylori J99
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238027..238824
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSASDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSDDVKLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagcgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctagtgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaatatcttttttagcaataaaagcgatgat
gtgaaattagttgcagaaaccaatcaaaaaatccaagcccttaacgctacccagcaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttacattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttaaaagaaaacactgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttcttg
tatcattataaggcatga

DBGET integrated database retrieval system