KEGG   Helicobacter pylori J99: jhp0388Help
Entry
jhp0388           CDS       T00020                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpj  Helicobacter pylori J99
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417085..417576
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKSCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILKTSLGLRHFFALVFYIERRFGRARKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLTLQQILFKREEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagagatccttactaaccgctttttcccaagcctttttaaaaaaaggcttgat
ttttctaacagagtggttttagggctgggatctaatcttaaaaaccctttaaaaatatta
aaaagttgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcaccc
atttatatcaatccgccttttggttacactaatcaacctaacttttataacgctacgatt
atccttaaaacatctttaggtttgcgccatttttttgctctagtgttttatatagaaagg
cgttttgggcgtgcaaggaagcgcgattttaaagatgctccaagaactttagatattgat
attatcgctttcaatcaagtcattttgaggcagaatgatttgactttacctcaccctaaa
tggagtgaaagagactcggtgttagtgcctttaactttacaacaaatcctttttaaaaga
gaagagtggtga

DBGET integrated database retrieval system