KEGG   Helicobacter pylori J99: jhp0591Help
Entry
jhp0591           CDS       T00020                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpj  Helicobacter pylori J99
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    jhp0591 (galU)
   00052 Galactose metabolism
    jhp0591 (galU)
   00500 Starch and sucrose metabolism
    jhp0591 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    jhp0591 (galU)
Enzymes [BR:hpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     jhp0591 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654555..655376
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHEYPSVLKQMTSLYQKYQCSIVAIEEVVLEEVSKYGVIRGEWLEE
RVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFDILRETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccatccctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgtg
gaagaagcgatggaagcgggttgtgaagtgatggcgatcgttacaggcaggaataaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcaccaac
aaagaaaacgccttaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggggaagccctgataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgagtatccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggtgctagaagaagtttcaaaatacggcgtgatcaggggcgaatggttagaagag
agggtgtatgagattaaagacatggtagaaaaaccaagccaagaagacgccccaagcaat
ttagccgtgatagggcgctacattttaactccggatatttttgatattttgcgtgagact
aaaccgggtaaaaacaatgaaatccaaatcacagacgctttactcactcaagccaaaaga
aaacgcatcatcgcttaccaattcaaaggcaagcgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcctattataaaaaacgcttataa

DBGET integrated database retrieval system