KEGG   Helicobacter pylori J99: jhp0593Help
Entry
jhp0593           CDS       T00020                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpj  Helicobacter pylori J99
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
655798..657066
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGEVEISGAKNSALPILAATLLSHQEVKIKSLPQVVDIKAMALLLQNL
GAELEWLNPHTLQLSAKSLHHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEIAQLCAFLQSGGVEIEGVDSSELKIRGVESDALNLKDIQIIPDRIEAG
TCLCVGAITNSQLKINHIIPNHIQAITDKLIEIGFPLDIQENSIEIYPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSIIEETLFENRFMHASELQRLGANISLKTNVATISGS
TELTGSDVMATDLRASSALVLAALVAKGVSRVHRIYHLDRGYERLEDKVNALGAKVLRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaaggagaggtagaaatttcaggg
gcgaaaaattccgcgctccccattttagctgccacgcttttaagccaccaagaagtcaaa
atcaaatccttgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgcagaattagaatggcttaacccccacacgctccaactcagcgctaaatccctgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggtgttaggc
ccactattagcgcgctttaaagaatgcttggtgagtttgcccggtgggtgcgctatagga
gctaggcctgtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagtttagctaaaggg
atcacgcgcatcattaacgccgctaaagagccagaaatcgctcaattgtgcgcgttttta
caaagcggaggcgtagaaattgagggcgttgacagcagcgagctaaagattaggggggta
gaaagcgacgctttaaatttgaaagacattcaaatcataccggacaggattgaagcaggc
acttgtttgtgcgtgggggctatcactaacagccagcttaaaatcaatcatatcatccct
aaccatattcaagcgatcaccgataaactcatagaaattggtttcccgctagacattcaa
gaaaattctatagaaatttacccggccaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccgggctttcccacagacatgcaagcgcaattcatggcactagccacgcagtgt
ttggggactagtatcattgaagaaacgctttttgaaaaccgcttcatgcatgcaagcgaa
ttgcaacgcttgggggctaatattagcctaaaaacgaatgtggctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcaacggatttaagggcttcttcggctctcgtt
ttagccgctttagtggctaagggggtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattggaggataaagtcaacgctttaggggcaaaagtgttgcgtttaaaa
gaaaaataa

DBGET integrated database retrieval system