KEGG   Helicobacter pylori J99: jhp0815Help
Entry
jhp0815           CDS       T00020                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpj  Helicobacter pylori J99
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    jhp0815 (ruvA)
Enzymes [BR:hpj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     jhp0815 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(894351..894902)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEAHIEVQGVVYGVQVSMRTAALLQTGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDENRPARNEVFLALESLGFKSAEINPVLKTLKPHLSIEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctctgctttagaagcgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacggctgctttgctccaaacg
ggccaaaaagcgcgtttgaaaatcttacaagtgattaaagaagatgcgcatcttttatac
gggtttttagaagagagcgaaaaaattctctttgaaaggcttttgaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcgccgaatgaatttgaaaacatt
atcgctactaaagaagtcaaaagactccagcaagtcccaggcatagggaaaaagctcgcc
gataagatcatggtggatttgattggctttttcattcaagatgaaaacagacccgcgcgc
aatgaagtctttttagccctagagagtttgggctttaaaagcgctgaaatcaatccagtt
ttaaaaaccctaaaaccccatctcagcatagaggcagcgattaaagaagccttacagcaa
ctgcgctcttaa

DBGET integrated database retrieval system