KEGG   Helicobacter pylori J99: jhp0859Help
Entry
jhp0859           CDS       T00020                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpj  Helicobacter pylori J99
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954488..955069
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALRNALENLKT
CASCNALSETEVSEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEDVDFN
ALEKRLIGENIKEIIFAFPPTLANDSLMLYIEDKLQHLHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttggaaaac
ccttatctggcgcttaagatcacgcacgctttaagaaacgccctagaaaaccttaaaaca
tgcgcatcttgtaacgcgctcagcgagactgaggttagtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagacgtgtttattttagaagac
ttaaaggactttttagggcgctattatgtgttaaattctatagaagacgtggattttaac
gccctagaaaaacgcctgattggagaaaacattaaagaaatcatttttgctttccctccc
actttagctaatgattctttaatgctctatattgaagataaattacaacacctccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactcc
gtttcgctctcaagggcgtttaattcaaggatcaaggcatga

DBGET integrated database retrieval system