KEGG   Helicobacter pylori J99: jhp0862Help
Entry
jhp0862           CDS       T00020                                 

Gene name
folE_1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpj  Helicobacter pylori J99
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    jhp0862 (folE_1)
Enzymes [BR:hpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     jhp0862 (folE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957131..957343
Genome map
AA seq 70 aa AA seqDB search
MEKFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNISSCLF
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttttcaaccaattttttgaaaacatcggcgaagacaagaatcgagaaggt
ttgaaagagacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacatttcatcttgccttttttaa

DBGET integrated database retrieval system