KEGG   Helicobacter pylori J99: jhp0890Help
Entry
jhp0890           CDS       T00020                                 

Definition
hypothetical protein
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
hpj  Helicobacter pylori J99
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(983580..984308)
Genome map
AA seq 242 aa AA seqDB search
MEKAYKLLSVQENISHKKAKALIDSGLVSIGGQKLMVARKELPQNTRFSVQKVEKPSVIF
EDENILALFKPPFIESYDLVSFFKGWALLHRLDKETSGVILLVKENSEFHLKAKKAFKDR
AVKKEYLAIVQGIIEEEREINAPILTIKTTKAFSKISKKGQEAVTIITPLKIINKKTLLK
VGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPSSAKRLMLHAHKIALLGYEFEAIAPKEF
EI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcttacaaattattgagcgttcaagaaaacatttcgcataaaaaagctaaa
gctctgatcgattcagggttagtgagcataggggggcagaaattgatggttgccagaaag
gaattgccccaaaacacgcgctttagcgtccaaaaagttgaaaaacccagcgtgattttt
gaagatgaaaacattctagccctttttaaacccccttttatagagagctatgatttagtt
tcttttttcaaaggttgggcgttgttgcaccgcttggataaagaaacaagcggggtgatt
ttattggtgaaagaaaattcagaattccatttaaaagctaaaaaggcttttaaagacagg
gcggttaaaaaggagtatttagcgatcgttcaaggcatcatagaagaagagcgagagatc
aacgcccccattcttaccattaaaaccactaaagctttcagtaaaatctctaaaaaaggg
caagaagcggttacgattatcacgcccttaaaaatcatcaacaaaaaaacccttttaaaa
gtggggatcaaaaccggaagaacccaccagatcagagtccatttaaagcatatcaaccac
cccattataggcgatacgctctataataacgagccaagttcagccaaacgcttgatgctc
catgcgcataaaatcgcgctgttagggtatgaatttgaagcgatcgctcctaaagaattt
gaaatttaa

DBGET integrated database retrieval system