KEGG   Helicobacter pylori J99: jhp1035Help
Entry
jhp1035           CDS       T00020                                 

Gene name
porG
Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jhp1035 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jhp1035 (porG)
   00020 Citrate cycle (TCA cycle)
    jhp1035 (porG)
   00620 Pyruvate metabolism
    jhp1035 (porG)
   00640 Propanoate metabolism
    jhp1035 (porG)
   00650 Butanoate metabolism
    jhp1035 (porG)
  Energy metabolism
   00680 Methane metabolism
    jhp1035 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    jhp1035 (porG)
Enzymes [BR:hpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     jhp1035 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148339..1148899
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagctggacaaggcgctatcaccggcgctaaggga
ctagctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcttatggttca
gctaaaaggggagccgctatgatggcttataaccgcgttgatgatgagcctattttaaac
catgagcgcttcatgcaaccggattatgtgctagtgattgaccctggtttggttttcatt
gagaacattttcgctaatgaaaaagaagacacgacctatatcatcactagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttggtggat
tgtttaaaaatctctatggaaaccttaaaacgccctatccctaacacgcccatgctaggg
gcgttgatgaaagtgtctggcatgcttgaaattgaggcttttaaagaagcttttaaaaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system