KEGG   Helicobacter pylori J99: jhp1037Help
Entry
jhp1037           CDS       T00020                                 

Gene name
porA
Definition
pyruvate flavodoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jhp1037 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jhp1037 (porA)
   00020 Citrate cycle (TCA cycle)
    jhp1037 (porA)
   00620 Pyruvate metabolism
    jhp1037 (porA)
   00640 Propanoate metabolism
    jhp1037 (porA)
   00650 Butanoate metabolism
    jhp1037 (porA)
  Energy metabolism
   00680 Methane metabolism
    jhp1037 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    jhp1037 (porA)
Enzymes [BR:hpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     jhp1037 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1149317..1150540
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggacggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgccatgagtgcatgcgtgggagctgccgctgctggtggg
agggtcagcactgcgactagctctcaaggcttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttggtcaatcgcgctttagcggcccct
ttaaacatccatggcgatcattctgatatgtatttaagcagggattctggctggatcagt
ttatgcacatgcaacccccaagaagcttacgatttcactttaatggcgtttagaatcgca
gagcatcaaaaagtgcgcgtgcctactattgtcaatcaagatggctttttatgctcgcac
accgtgcagaatgtccgccctttgagcgatgcagtggcttatcaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgctattatgagtgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcaggcaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggccact
atccattccttacgccctttcccttatgaaagattggggcaggatttgaaaaatcttaag
gctctagcgattttagacaagagctctccagcgggcgctatgggagcgatgtttaatgaa
gtaacgagtgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgtgcatttatgcgagatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system