KEGG   Helicobacter pylori J99: jhp1038Help
Entry
jhp1038           CDS       T00020                                 

Gene name
porB
Definition
ferrodoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hpj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpj00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hpj00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpj00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpj00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpj00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1150553..1151497
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQRPKFVAFGGDGASYDIGFQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFNSNKTIELADM
AVDSLMFPLFEVFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgtccaggttgtgggcatggcatcattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tacccgcacacttcatgggatgtgccttggattcatatcggttttgaaaacggctctacg
gcgatttcaggggtggaagcgatgtataaggctttagtgaataagggtcgctatcaaggt
caaagaccgaaatttgtggcgtttggaggcgatggggccagttatgatattggttttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggatctacgccattaggggctagcacctct
accacgccagcgggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggtcccttatgtggcgcaactctcgcctaacaaatggaaagac
atgaataaaaagattaagaccgcgctagacactgaagggccttgctttatcaacgctctt
agcccatgcacgactgaatggaaatttaattccaataagaccattgaattagcggatatg
gctgtggatagtttgatgttccccttgtttgaagtctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgtttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system