KEGG   Helicobacter pylori J99: jhp1153Help
Entry
jhp1153           CDS       T00020                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpj  Helicobacter pylori J99
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1284286..1285428
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDR
LKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaagcgctctgcaaaaaataggccca
gaaaagatcgcgcaaacccacatgcgccaaaaaggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgctgcgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgcattttggctaaagagcctttttatgatggggtgttgatt
gcgagtgctaagcaattagaacgccttattgtgaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccacctcaaagccaaaaagcctaacgccccacag
atcatggcaatcttgaatctcacgccggatagtttctatgaaaagagccggtttgatagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccacagagtgaaatcattgatcccaaagtagagcaagatcgc
ttgaaagaaattttattagagatcaaatcccaaaaactctaccaacgcgcccaatttagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttctatcctt
aatgacgtgagcggttttaatagcattgaaatgctagaagtcgcaagagattaccagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgtcttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacacgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaagaccggctc
gccggcactttgagtttgcatttaatggcgttgcaaaatggagcgagtattttaagagcg
catgacattgatgagcatatcgatctcatcaaggtgtttaagagtttggaagaaacggat
tga

DBGET integrated database retrieval system