KEGG   Helicobacter pylori J99: jhp1196Help
Entry
jhp1196           CDS       T00020                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpj  Helicobacter pylori J99
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jhp1196
   00030 Pentose phosphate pathway
    jhp1196
   00051 Fructose and mannose metabolism
    jhp1196
   00052 Galactose metabolism
    jhp1196
   00500 Starch and sucrose metabolism
    jhp1196
   00520 Amino sugar and nucleotide sugar metabolism
    jhp1196
  Nucleotide metabolism
   00230 Purine metabolism
    jhp1196
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    jhp1196
Enzymes [BR:hpj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     jhp1196
    5.4.2.8  phosphomannomutase
     jhp1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329298..1330677
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEVLS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKNTLLNAKHEIKPLKETPEKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGDFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNAINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIRNLQEALKNPPSHFPTIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttgggaaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgttttttgtttgaagttttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaatatccaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaaaacacgcttttaaacgcaaagcatgaaata
aagcccctaaaagaaacgccagagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaatcttaaatacaaaatcgccctggattttggtaat
ggcgtgggggcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatggggattttcctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagacttagaaaaacacatgcgagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatctatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacgcaatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcaaagaaactaatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgacttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcgcaacttacaagaagcgcttaaaaacccgccaagccat
ttccctacaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggc
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagaatataaaagggcgttgcttgggctattagaaaaactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system