KEGG   Helicobacter pylori J99: jhp1410Help
Entry
jhp1410           CDS       T00020                                 

Gene name
res_2
Definition
type III restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpj  Helicobacter pylori J99
Brite
Enzymes [BR:hpj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     jhp1410 (res_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1547376..1550285)
Genome map
AA seq 969 aa AA seqDB search
MKIKFKRLDYQEQCRDQILGVFKGIDLREPENDIQRIANPVFEIGAIKDLLLENIENLRS
KQKITQGSVGINQSLNCDILMETGTGKTFCFLECVYALHKNYHLSKFIVLAPSNAIKLGV
LKSIEITREFFKSEYSNTHLESYEDVERFILASNHKCCVLVMTFSAFNKEKNTINQSCLE
NTNLFNGAKSYMQALASMRPIVIMDEPHRFLGDKTKKYLEQLNALITLRFGATFKDDYHN
LIYALDSKKAFDCALVKSISVASVGESDEYFLELKEANKKQNEATINYTTLENKIQSVKV
KTHDNLGALTHISALEDYIVEKITKTEIRFLNGFNLLLDQKEPFSHLLEGEQEVMLKEAI
KSHFEREEGLFKKGIKALCMVFINGVNSYLSENEKPAKLALLFEKLYQQKLEEVLKKPLD
ENYRAYLERTKDAILKVHGGYFAKSKKESDEVQVIALILKEKEKLLSFDSDLRFIFSQWA
LQEGWDNPNVMTICKLAPSSSNITKLQQIGRGLRLAVNDKGERITKEHADFDFVNELVVI
VPQVEGDFVGAIQQEISEHSLIKQVFSAEELEKSGMVKKGYYGVLFETLEGLGFGEKTDD
ENFKLTLNQNEFLKKEPELEKLKDEKYLDFEKLKDFLKDRLIGHFRVRNKNERKTEKIKI
NKENFKKFETLWAGLNHQARIAYAIDSESLIDEIVKNINSSFNVSSKIVSVTTHKKVETM
GNNAKTEIFERKSACVWSLHEFISALSNKVKLSFKSVAKVLENIDENKFNEIKKNEQEGL
KRLEELFLEIIYQNIKDKISYQMRETTIKNRKNDAFYDEKGEIREFLDGSLGADKYEIKN
SSAQEKCLYENFMQVDSEIEKDTIEESNDTKIIVFGKLPRVKIPIGLNQTYSPDFGYVVE
NNDKKVLLVVETKGVDKKSELRPEEKRKISTAKKFFEALKKQGVNIEYKTKLNNDQLSAL
INEVLNRKD
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcaaattcaaacgattggattatcaggagcaatgccgggaccaaattttaggg
gtgtttaaggggattgatttaagagagccagaaaatgatattcaaaggattgctaaccct
gtttttgaaataggggcgatcaaagatcttttattagaaaatattgagaatttgcgatcg
aaacaaaaaataacccaggggagcgtggggattaatcagtcgttaaactgcgatatttta
atggaaacaggcaccgggaagaccttttgctttttggaatgcgtttatgccttgcacaaa
aactaccatttgtcaaaatttatcgttttagcgccaagcaacgccattaaattaggggtt
ttaaagagtattgaaatcaccagagaattttttaaaagcgagtattctaacacgcattta
gaaagctatgaagatgtagaaagattcattctagcgagtaaccacaaatgctgcgtgttg
gtgatgactttttctgcctttaataaagagaaaaacactatcaatcaatcatgcttagag
aacacgaatctattcaatggcgcaaaaagttacatgcaagctttagcgagtatgcgcccc
atcgtaatcatggacgaaccgcaccgatttttaggcgataaaacaaaaaaatatttggaa
caattaaacgctttaatcacgctcaggtttggggcgacttttaaagatgattatcataat
ttgatttatgcgctagatagcaaaaaagcgtttgattgcgccctagtgaaaagcattagc
gtggcgtctgtgggggagagtgatgagtattttttagagcttaaagaggctaacaaaaaa
caaaatgaagccacgatcaattacacgactttagaaaataaaattcaaagcgtcaaagtc
aaaacgcatgataatttaggtgcgctaactcatatcagcgctttagaagattacattgta
gaaaaaatcactaaaactgagattcgttttctcaatggctttaatttgttactggatcaa
aaagagcctttttcccatcttttagagggcgagcaagaagtgatgctgaaagaagcgata
aaaagccattttgaaagagaagaagggctttttaaaaaagggattaaagccttgtgcatg
gtgtttattaacggggtgaatagctatttaagcgaaaatgaaaagccggctaaattggcc
cttttatttgaaaaactctaccagcaaaagcttgaagaagtcttaaaaaagcctttagat
gaaaattatagagcgtatttagagcgcaccaaagacgctattttaaaagtgcatggaggg
tattttgccaaaagcaagaaagagagcgatgaagtccaagtgatcgcactcattttaaaa
gaaaaagaaaaattgctgagttttgattccgatctcaggtttattttttcgcaatgggcg
ttgcaagaggggtgggataaccctaatgtgatgacgatttgcaaattagcccctagctct
tctaatatcactaaattgcaacaaatcggtagggggttaaggctcgctgtgaatgataag
ggcgaacgcatcactaaagagcatgctgattttgattttgtcaatgaattggtggtgatc
gtgccgcaagttgagggggattttgtgggagcgatccagcaagagataagcgaacatagc
ttgattaaacaagtatttagcgcagaagagttagaaaaaagcggcatggttaaaaaaggg
tattacggggttttgtttgaaacattagagggtttgggttttggagaaaaaacagatgat
gaaaactttaaactcactctcaaccaaaacgaatttttaaaaaaagagccagaacttgaa
aaattaaaagatgaaaaatacctggattttgaaaaattaaaagattttttaaaagatcgc
ttgattggccattttagagttaggaacaaaaacgagcgaaaaactgaaaaaatcaaaatc
aataaagaaaattttaaaaaatttgaaaccttatgggcgggtttgaatcatcaagcccgg
atcgcttatgccattgatagcgagagtttgattgatgagattgtcaaaaatattaattct
tcttttaatgtcagttcaaaaatcgtttcggttacgacgcataaaaaagtagaaacgatg
ggaaataacgccaaaacagagatttttgagcgaaaaagtgcatgcgtgtggagtttgcat
gaatttatcagcgccttgtctaataaggtgaaattgagttttaaaagcgtggctaaagtg
ttggaaaacattgatgaaaacaagtttaatgaaattaaaaaaaacgaacaagagggctta
aagcgcttagaagagctgtttttggaaattatttatcaaaatattaaagataaaatctcc
tatcaaatgcgcgaaacgacgattaaaaacagaaaaaacgatgcgttttatgatgaaaaa
ggagaaatcagagagtttttagacgggagtttgggggcggataaatatgagattaaaaat
tcaagcgctcaagaaaaatgcctgtatgaaaatttcatgcaagtggatagcgagattgaa
aaagacacgattgaagaatctaacgacactaaaatcattgtttttggcaagctccctagg
gttaagatcccaatagggttaaatcaaacttatagccctgattttgggtatgtggttgaa
aataacgataaaaaagtgttgttagtggtggaaactaagggggttgataaaaaaagcgaa
ttacgccctgaagaaaagcggaaaatttcaaccgctaagaaattttttgaagctttaaaa
aagcaaggcgtgaatattgaatacaaaaccaagttgaataatgatcaattgagcgcgttg
atcaatgaagttttaaatcgtaaagattag

DBGET integrated database retrieval system