KEGG   Halanaerobium praevalens: Hprae_0010Help
Entry
Hprae_0010        CDS       T01941                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hpk  Halanaerobium praevalens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hprae_0010
Enzymes [BR:hpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Hprae_0010
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hprae_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16934..18430
Genome map
AA seq 498 aa AA seqDB search
MENYILAIDQGTTSSRAIIFNHDGAIVSVAQKEFTQHFPKPGWVEHDPDEIWGTTLAVIA
DAMGTKDIKPSQISAIGITNQRETTVVWDAETGKPIHNAIVWQDRRTAAICDDLKDQGLE
EEIKDKTGLVVDAYFSGTKIKWLLDNVEGARERAEAGELRFGTIDSWLIWKLTGGNTHVT
DYTNASRTLIYNIKDLHWDDELLETLDIPKSMLPEVKQSSEVYGKTVDYHFFGAEVPIAG
IAGDQQAATFGQVCYEEGMAKNTYGTGCFMLMNTGEEPVKSENGLLTTIAYGIDGKVNYA
LEGSIFIAGAAIQWLRDELNLIDNAPDSEYFAKKVDTTDGVYVVPAFSGLGAPYWDMYAR
GTIVGLTRGTSKEHLIRATLESLAYQTRDVLEAMEADSGIDLKTLRVDGGAAMNDFLMQF
QADILGTEVERPEINETTALGAAYLAGLAVGYWDNLDELVAKWKKDSLFVPNMANEKREK
LYADWKRAVERAKGWSEE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactatattttagcgattgatcaaggaactactagctcaagggcaataattttt
aatcatgatggagctattgttagtgtagctcaaaaagaatttactcagcattttccaaag
cctggttgggtagaacatgatcctgatgaaatttggggtactacacttgctgttattgct
gatgctatgggtactaaagatattaaacctagtcaaatttctgcaattggtattacaaac
cagcgtgaaactacagtagtttgggatgctgaaactggtaaaccaatccataatgctatt
gtctggcaggatagaagaactgcagcaatttgtgatgatttaaaagaccagggattagaa
gaagaaatcaaagataagactggtttagtagtagatgcgtatttctctggaactaaaatt
aaatggttattagataatgttgaaggagctcgcgaaagagctgaagctggggaattaaga
tttggtacaattgatagttggttaatttggaaattaactggtggtaatacacatgtaact
gattatactaatgcttctagaactcttatttataatataaaagatttacattgggatgat
gaattattagaaactttagatattccaaaatcaatgttaccagaagttaaacaatctagt
gaagtttatggtaaaactgttgattatcatttctttggagctgaagttccaattgcaggt
atagctggtgaccagcaggctgcaacctttggtcaagtttgttatgaagaaggaatggct
aaaaatacttatggtacaggttgctttatgttaatgaatactggagaagagcctgtaaaa
tctgaaaatggattattaacaactattgcttatggtattgatggtaaagttaattatgct
cttgaaggatcaatctttatagcaggtgctgctattcagtggttaagagatgaattaaac
ttaattgataatgcacctgattcagagtattttgctaaaaaagtagatacaactgatggt
gtttatgtagttccagctttctctggtttaggagctccatactgggatatgtatgctaga
ggaactattgttggtttaacaagaggtacttctaaagaacatttaattcgcgctacttta
gaatcacttgcttaccaaacaagagatgtactagaagctatggaagctgattctggtata
gatttaaaaactctaagagtagatggtggagcagcaatgaatgacttcttaatgcaattc
caggcagatattttaggtacagaagtagaaagacctgaaattaatgaaacaactgcttta
ggtgctgcttatcttgctggtttagctgttggttattgggataatcttgatgaattagta
gctaagtggaaaaaagattctctcttcgtaccaaatatggctaatgaaaaacgtgaaaaa
ctttatgcagactggaaacgtgctgtagaaagagctaaaggatggtctgaagaataa

DBGET integrated database retrieval system