KEGG   Halanaerobium praevalens: Hprae_0075Help
Entry
Hprae_0075        CDS       T01941                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hpk  Halanaerobium praevalens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hpk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpk00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hpk00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpk00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpk00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpk00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpk00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
92939..93508
Genome map
AA seq 189 aa AA seqDB search
MQIRWHGRGGQGAKTASLLLADAAFSTGKYVQGFPEYGPERMGAPITAYNRISDEKIRVH
SNIYNPNYVVVVDETLLESVDVTAGLKEDGAIVVNTAKAGEKIREKLKGYQGELYTVDAR
EISMETIGRYFPNTPMLAGLVKVAEIMPENDFIEEMGNLFKKKFASKPEVIEGNVAALKR
ALKEVKTHG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcagatggcatggtagaggcggccagggagcaaaaactgcttctctactttta
gcagatgcagctttttctaccggcaaatatgtacaggggtttccagaatatggcccagaa
agaatgggagcaccaattacagcctataatagaattagtgatgaaaaaataagagttcac
tctaatatttacaacccgaattatgtagttgtagtagatgaaacacttttagaaagtgta
gatgttacagcaggtttaaaagaagatggagcaatagttgtgaatacagctaaagctgga
gaaaaaattagagagaaattaaaaggatatcaaggtgaattatatacagtagatgcaaga
gaaatttcaatggaaacaataggtagatattttccaaataccccaatgttagcaggttta
gtgaaggtagcagaaataatgcctgagaatgattttatagaagaaatgggcaatttattt
aagaaaaaatttgcttctaagccagaagttatagagggtaatgtagcagcattaaaaaga
gctttaaaagaggtgaagacacatggttaa

DBGET integrated database retrieval system