KEGG   Halanaerobium praevalens: Hprae_0386Help
Entry
Hprae_0386        CDS       T01941                                 

Definition
glycoside hydrolase family protein
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
hpk  Halanaerobium praevalens
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hpk00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hpk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442499..445474
Genome map
AA seq 991 aa AA seqDB search
MLREYFNDLNILEKNRLAARAYFKRPIKNLKGMWNFKFFDSPKRITENVILNKADQSWET
IRVPSCWQLEGYGQMHYTDLYYQFPLAPPLVPIINPTGVYKKEFNLNEDLTNKEAILRFH
GVDSAFAVYLNQKFIGYSQGSRMISEFKIDPFLKSKNELTIVVYKWSDGSYLEDQDMWWF
SGIFRDVELEITDQVNIWDYKFKNKFDQEYKLADALFEIKVRGLEFIDKKNWTLRAIIKD
QNSVLAEAKFKLKEKIDFKFEKLVVNKWTAETPNLYQMKLEIYDAENNLRDKIEDKIGFR
EIKIKNNKILLNGKKIMFRGVNRHEFNQDTGRTITKKEMLDDVLMMKKNNINAVRTAHYP
NSVYFYQLCDQYGLYVIDEADLECHGFELTSDYKKITVDQAWEKAFIDRIKRLVERDKNR
ASVLIWSLGNESEYGHNFKKMAQVAKNIDPTRPLHYEGDKNTESTDIYSTMYSSIEKLEE
IGRNNNNTKPHIHCEYAHAMGNGPGSLQDYWNIYEKYERLHGGFVWEWVDQGIRTVDKNG
NLYYKYGGDYGEQPHNANFNLDGLLFPDRSPSPGLIEYKQVIAPIKFKIVNLEAGIFSIE
NKYNFIDLGSYKLDWEIKSAGKIYKSNTTNLRGIKAGESQDIIINLKNIDYNKSKEAYYI
YFTVSLKETQKWAEIGHLISREAFEIKSKQKHIKLEKLKEDNTGEIVIEKNSDTLKLNTK
KAEIIFDKIKGNLKSYSYQGEEVLLSGPQFSCWRAPIDNDMYILKEWKEKYFLNLMKNYN
EEFSYKQKNNGILVKTKSVFGGPNQEWFYQLESEYWVDNQGRIKFKFIGELRDPAGVMQT
MLPRIGFDYQLHSSFTQFSWLGRGPHENYSDSKTSALIDLYEKKLEELYTPYPYPQTNGN
RSDLSWLEISNKSKKIKFSSENNFNFSAHQYKESDFEKSKHLNDLKARDKIFLKLDYKQN
GLGSNSCGPQQLSKHRLKAVNFIFELKMEVE
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagaatattttaatgacttaaatattttagaaaaaaatagattagctgcaaga
gcttattttaaaagacccataaaaaatttgaagggaatgtggaattttaagttttttgat
tctcctaaaagaattacagaaaatgtaatcctaaataaagctgaccaaagttgggaaaca
attagagtgccttcttgttggcaattagaaggttatggtcaaatgcattatacagattta
tattatcaatttcctttagctcctcctttagttccaattattaatccaacaggtgtttat
aaaaaagaatttaacttaaatgaagatttaacaaataaagaagcaatacttagatttcac
ggtgttgatagtgctttcgctgtttatcttaatcaaaaatttattggttatagccaagga
agtagaatgattagtgaatttaaaattgatccatttttaaagtctaaaaatgaattaact
attgttgtttataaatggtcagatggtagttatttagaagatcaagatatgtggtggttt
agcggtatttttagagatgttgaactagaaattactgatcaagttaatatttgggattat
aaatttaaaaataaatttgatcaagaatataaattagcagatgctttatttgaaatcaaa
gtaaggggtttagagtttatagacaagaagaattggactcttagagcaattattaaagat
cagaattctgttttggctgaagcaaaatttaagctgaaggaaaaaattgattttaagttt
gaaaaattagtagttaataaatggactgctgaaactccaaatttatatcaaatgaaatta
gaaatttatgatgctgagaataatttgagagataagatagaagataaaattggatttaga
gaaattaaaataaaaaataacaagatacttcttaatgggaaaaaaatcatgtttagagga
gtaaatagacatgagtttaatcaggatacaggaagaacaattactaaaaaagagatgtta
gatgatgttttaatgatgaaaaaaaataatattaatgcagtcagaacagctcattatcca
aattcagtttatttttatcaattatgtgatcaatatggcttatatgtaatagatgaagct
gacttagagtgccatggttttgaattaactagtgattataaaaaaataactgttgatcag
gcctgggaaaaagcatttattgaccgaataaaaaggcttgtagaaagagataaaaataga
gcttctgttcttatttggtctcttggaaatgaatctgaatatggtcataattttaaaaaa
atggctcaagtagctaaaaatattgatccaactaggcctttacattatgaaggagataaa
aatacagaatcaactgatatttatagtacaatgtactcttctattgaaaaattagaagag
attggcagaaataataataataccaaaccacatattcattgtgaatatgctcatgcaatg
ggaaatggaccaggtagtttacaagattattggaatatttatgaaaaatatgaaagattg
catgggggctttgtttgggaatgggttgatcaaggaattcgtactgttgataaaaatggt
aatctttattataaatatggtggtgattatggggagcagcctcataatgctaattttaat
cttgatggattactatttcctgatcgtagtccctcacctggattaatagaatataaacaa
gtaattgctcctataaagtttaaaatagtaaatttagaagctggtatttttagtatagaa
aataaatataattttatagatttgggttcttataaattagattgggaaattaagtctgct
ggaaaaatttataagagtaatactacaaatttaagaggaattaaagcaggtgaaagtcaa
gatataattattaatttgaaaaatattgactataataaaagtaaagaagcttattatata
tattttactgttagtttgaaagaaactcaaaaatgggctgaaattggtcatcttattagt
cgagaggcttttgagattaaatcaaaacaaaaacatattaaattagagaaattaaaagaa
gataatactggggaaattgtaatagaaaaaaactccgacacattaaaattaaatacaaaa
aaagcagaaataatatttgataaaataaaaggtaatttaaaatcttactcttatcaaggt
gaagaagttttgctttcaggtcctcaatttagctgttggcgagctccaattgataatgat
atgtatattttaaaagaatggaaagagaaatattttttgaatttaatgaaaaattataat
gaagaatttagttataagcaaaaaaataatggaattttagttaaaactaaaagtgttttt
ggtggccctaaccaagaatggttttatcaacttgaatctgaatattgggttgataatcag
ggaagaattaaatttaagtttattggcgaattaagagatccagctggagttatgcagact
atgttgccaagaattgggtttgattatcaattacatagttcttttacacagtttagctgg
ttaggaagagggccacatgaaaattatagtgatagtaaaactagtgctttaatagattta
tatgaaaagaaattagaagaattatatactccatatccttatccgcaaacaaatggaaac
cgcagtgatctttcttggttagaaataagtaataaatctaagaagatcaaattctctagt
gaaaataattttaattttagtgctcaccagtataaagaatctgattttgaaaaatcaaaa
catttaaatgacttaaaagcaagagataaaatttttctaaaattagattataagcaaaat
ggattgggaagtaatagctgtggtcctcaacagctaagtaaacatcgtttgaaagcagtt
aactttatttttgaattaaaaatggaagtagaataa

DBGET integrated database retrieval system