KEGG   Halanaerobium praevalens: Hprae_0586Help
Entry
Hprae_0586        CDS       T01941                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00010  Glycolysis / Gluconeogenesis
hpk00052  Galactose metabolism
hpk00500  Starch and sucrose metabolism
hpk00520  Amino sugar and nucleotide sugar metabolism
hpk00521  Streptomycin biosynthesis
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
Module
hpk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hpk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_0586
   00052 Galactose metabolism
    Hprae_0586
   00500 Starch and sucrose metabolism
    Hprae_0586
   00520 Amino sugar and nucleotide sugar metabolism
    Hprae_0586
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hprae_0586
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hprae_0586
Enzymes [BR:hpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hprae_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG PCNA_N
Motif
Other DBs
NCBI-ProteinID: ADO76740
UniProt: E3DPR5
Position
653656..654630
Genome map
AA seq 324 aa AA seqDB search
MQEYYLGLDLGGTKILTGLADDKGKIITRSRRDTEAELGEDKIIKNMIKTIKDVLNKANV
NKNQIRALGIGSPGPLDAQKGIIIENSNLPWKNVPLVKKIESALGIKTLLKNDANAAALG
EKWFGAGKDVDNLVYLTISTGVGGGAIINKKLFTGVNDNACELGHTIIDPNGPLCGCGNH
GCLEAFAAGTSIAKRAREAAAAGKSKKILDLADNIISDIDAVICAQAAYQGDQVAKDIFQ
NAGYYLGLGLANVINIFNTEMIILGGGVMKASDLFLDKALATMKEFALAGSLELVTVKEA
ELGSDIGLMGAIAVAMEARLIKND
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatattatttaggacttgatttaggaggaactaaaatcctaactggtctagca
gatgataaaggaaagattataacaagatcaagaagagatactgaagctgagcttggtgaa
gataaaataataaagaatatgattaagactataaaagatgttttaaataaggcaaatgtt
aataaaaatcaaattagagccttgggaattggtagtcctggccctttggatgctcaaaag
ggaattataattgaaaattctaatttgccttggaaaaatgtacctttagtaaaaaaaatt
gaatctgctttaggaattaaaactttacttaaaaatgacgcaaatgcagctgctttaggt
gaaaaatggtttggagctggtaaagatgttgataatttagtttatcttacaatttcaact
ggagttggcggaggagctattattaataaaaaattatttactggagttaatgataatgcc
tgtgaattaggtcatactattattgatcctaatggtcctttatgtggttgtggaaatcat
ggttgtttagaagcttttgcagcaggtacttctattgccaaaagagctagagaagcagca
gcagcaggaaaaagtaaaaaaatattagatttagctgataatattatttcagatattgat
gctgtcatttgtgctcaagctgcttatcaaggtgaccaagttgctaaagatatttttcaa
aatgcaggttattatttaggtctaggtttagctaatgtaattaatatttttaatactgaa
atgataattttaggtggaggagtaatgaaagcttctgacctatttttagataaggcttta
gctactatgaaagaatttgctttagcgggctctttagaactagttacagtaaaagaggca
gaattaggatcagatattggcttaatgggtgctattgcagtagcaatggaagctaggttg
atcaaaaatgattaa

DBGET integrated database retrieval system