KEGG   Halanaerobium praevalens: Hprae_0596Help
Entry
Hprae_0596        CDS       T01941                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpk  Halanaerobium praevalens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hprae_0596
   01230 Biosynthesis of amino acids
    Hprae_0596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hprae_0596
   00051 Fructose and mannose metabolism
    Hprae_0596
   00562 Inositol phosphate metabolism
    Hprae_0596
Enzymes [BR:hpk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hprae_0596
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hprae_0596
  Exosomal proteins of bladder cancer cells
   Hprae_0596
  Exosomal proteins of melanoma cells
   Hprae_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664444..665208
Genome map
AA seq 254 aa AA seqDB search
MRKPFICGNWKMNKNVDEAEKMINNLKAKVKDVDNVEMGICSTALCLTTVKEAAQGSELV
TGAENIYWKDSGAYTGEISAKMLAASDIEYTIVGHSERREIFGESDYEVNKKVLSALAHG
VKPIICVGETLEERKAEQIEAKVNFQVDSALAGLTEAEVADLVIAYEPIWAIGTGETASA
EEANRVIGIIRENIRKEYPEAADKVRIQYGGSVKPHNVEEIMAQPEIDGALVGGASLEAE
SFSEIILKTAKIYK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccatttatttgtggaaattggaaaatgaataaaaatgttgatgaagctgaa
aaaatgattaacaatttaaaagctaaagtaaaagatgtagataatgtagaaatgggtatt
tgttcaacagcactgtgtttaacaacagttaaagaagctgctcagggtagtgagcttgta
actggtgctgaaaatatttactggaaagattctggtgcttatactggagaaatttctgct
aagatgttagctgctagtgatatagaatacactattgtaggtcattctgagcgcagagaa
atttttggagaaagtgattatgaggtgaataaaaaagttctttcagcactagcacatgga
gtaaaaccaattatttgtgttggagaaactttagaagaaagaaaagctgaacaaatagaa
gcaaaagttaattttcaagttgattctgctctagctggattaactgaagcagaagttgca
gatctagttattgcttatgaacctatttgggcaattggtacaggtgaaactgcttccgcg
gaagaggcaaatcgagttattggaattattagagaaaatattagaaaagaatatccagaa
gctgctgataaagttagaattcaatatggtggtagtgttaaaccacataatgtagaagaa
attatggctcaacctgaaattgatggtgccttagttggtggagccagtttagaagcggag
tctttttctgaaataatattaaagactgccaaaatctataagtaa

DBGET integrated database retrieval system