KEGG   Halanaerobium praevalens: Hprae_0676Help
Entry
Hprae_0676        CDS       T01941                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpk  Halanaerobium praevalens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
754105..754701
Genome map
AA seq 198 aa AA seqDB search
MIGYLEGEVIEAEFNKVILGINGIGYELELAGFTKQPRLGQKLEVFTYTYVREDVLKLFA
FPEKSYKQLFEILITVNGIGPSAGLNILNTMPAARFISAILQKNEVTLKEISGIGPKTAQ
RLILELQSKLEDFAYLQNNNDSEPVVTEEDRQDIVDALTVLGYKISEINKALREIEFESE
TNVSEKIKLTLSQLGKER
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgataggttatttagaaggtgaagtaattgaggctgagtttaataaagttattttggga
attaatggtatagggtatgagcttgaattagctggctttactaaacaacctcgtttaggt
caaaaattagaagtttttacatatacttatgtccgcgaggatgttttgaaattatttgct
tttcctgaaaaaagttataaacagttatttgaaattttgattactgttaatggtataggt
ccaagtgctgggctaaatattttaaatacaatgcctgctgctagatttatttcagctatt
ttacaaaaaaatgaagtaactttaaaagaaatatcaggtattggtcctaaaactgctcaa
agattaatacttgagctgcaaagtaaattagaagactttgcctatttacaaaataataat
gattcagagccagtagtaactgaagaagatagacaagatattgtagatgccttaactgta
ttaggttataaaatatcagaaataaataaggcgttgagggaaattgaatttgaaagtgaa
actaatgtatcagaaaaaataaaattaactcttagccagctgggtaaggagaggtaa

DBGET integrated database retrieval system